PGF (Human) Recombinant Protein
  • PGF (Human) Recombinant Protein

PGF (Human) Recombinant Protein

Ref: AB-P9038
PGF (Human) Recombinant Protein

Información del producto

Human PGF (P49763, 19 a.a. - 131 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name PGF
Gene Alias D12S1900|PGFL|PLGF|PlGF-2|SHGC-10760
Gene Description placental growth factor
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MKHHHHHHASLPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECR.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS and 5% w/v trehalose, pH 7.4.
Gene ID 5228

Enviar uma mensagem


PGF (Human) Recombinant Protein

PGF (Human) Recombinant Protein