View larger
Human PTN (P21246) recombinant protein with His tag at N-Terminus expressed in <i>Escherichia coli</i>.
AB-P9028
New product
PTN (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | PTN |
| Gene Alias | HARP|HBGF8|HBNF|NEGF1 |
| Gene Description | pleiotrophin |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MKHHHHHHHMLVPRGSGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 0.1M phosphate buffer and 0.1M NaCl, pH 7.2. |
| Gene ID | 5764 |
More info
Human PTN (P21246) recombinant protein with His tag at N-Terminus expressed in Escherichia coli.