View larger
Human PECAM1 (P16284, 28 a.a. - 601 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in <i>Baculovi
AB-P9019
New product
PECAM1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | PECAM1 |
| Gene Alias | CD31|PECAM-1 |
| Gene Description | platelet/endothelial cell adhesion molecule |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | QENSFTINSVDMKSLPDWTVQNGKNLTLQCFADVSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTTAEYQVLVEGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKREKNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELVTVTESFSTPKFHISPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVAHN |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Phosphate Buffered Saline (pH 7.4) and 10% glycerol. |
| Gene ID | 5175 |
More info
Human PECAM1 (P16284, 28 a.a. - 601 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.