Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
Pdgfb (Rat) Recombinant Protein
Abnova
Pdgfb (Rat) Recombinant Protein
Ref: AB-P9013
Pdgfb (Rat) Recombinant Protein
Contacte-nos
Información del producto
Rat Pdgfb (Q05028) recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
2 x 10 ug
Gene Name
Pdgfb
Gene Alias
SIS|c-sis
Gene Description
platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
Storage Conditions
Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT.
Form
Lyophilized
Antigen species Target species
Rat
Storage Buffer
Lyophilized from 1xPBS, pH 7.0.
Gene ID
24628
Enviar uma mensagem
Pdgfb (Rat) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*