PDGFA (Human) Recombinant Protein
  • PDGFA (Human) Recombinant Protein

PDGFA (Human) Recombinant Protein

Ref: AB-P9003
PDGFA (Human) Recombinant Protein

Información del producto

Human PDGFA (P04085) recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name PDGFA
Gene Alias PDGF-A|PDGF1
Gene Description platelet-derived growth factor alpha polypeptide
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized without any additives.
Gene ID 5154

Enviar uma mensagem


PDGFA (Human) Recombinant Protein

PDGFA (Human) Recombinant Protein