OTOR (Human) Recombinant Protein
  • OTOR (Human) Recombinant Protein

OTOR (Human) Recombinant Protein

Ref: AB-P9002
OTOR (Human) Recombinant Protein

Información del producto

Human OTOR (Q9NRC9, 26 a.a. - 128 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name OTOR
Gene Alias FDP|MGC126737|MGC126739|MIAL|MIAL1
Gene Description otoraplin
Storage Conditions Store, frozen at -20C for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE.
Form Liquid
Antigen species Target species Human
Storage Buffer Phosphate buffered saline (pH7.4), 30% glycerol and 1mM DTT.
Gene ID 56914

Enviar uma mensagem


OTOR (Human) Recombinant Protein

OTOR (Human) Recombinant Protein