OSM (Human) Recombinant Protein
  • OSM (Human) Recombinant Protein

OSM (Human) Recombinant Protein

Ref: AB-P8994
OSM (Human) Recombinant Protein

Información del producto

Human OSM (P13725) recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name OSM
Gene Alias MGC20461
Gene Description oncostatin M
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR.
Form Lyophilized
Antigen species Target species Human
Storage Buffer PBS pH-7.4.
Gene ID 5008

Enviar uma mensagem


OSM (Human) Recombinant Protein

OSM (Human) Recombinant Protein