TNFRSF11B (Human) Recombinant Protein
  • TNFRSF11B (Human) Recombinant Protein

TNFRSF11B (Human) Recombinant Protein

Ref: AB-P8992
TNFRSF11B (Human) Recombinant Protein

Información del producto

Human TNFRSF11B (O00300, 22 a.a. - 401 a.a.) partial-length recombinant protein with FLAG tag at N-Terminus expressed in HEK293 cell.
Información adicional
Size 2 x 10 ug
Gene Name TNFRSF11B
Gene Alias MGC29565|OCIF|OPG|TR1
Gene Description tumor necrosis factor receptor superfamily, member 11b
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq PGDYKDDDDKPAGETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKD
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH7.5 and 5% (w/v) Trehalose.
Gene ID 4982

Enviar uma mensagem


TNFRSF11B (Human) Recombinant Protein

TNFRSF11B (Human) Recombinant Protein