View larger
Human ITLN1 (Q8WWA0, 17 a.a. - 313 a.a.) partial-length recombinant protein expressed in <i>Escherichia coli</i>.
AB-P8987
New product
ITLN1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | ITLN1 |
| Gene Alias | FLJ20022|HL-1|HL1|INTL|ITLN|LFR|hIntL|omentin |
| Gene Description | intelectin 1 (galactofuranose binding) |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MWSTDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGG |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCL, pH-8, 0.4M Urea and 10% Glycerol. |
| Gene ID | 55600 |
More info
Human ITLN1 (Q8WWA0, 17 a.a. - 313 a.a.) partial-length recombinant protein expressed in Escherichia coli.