View larger
Human NPPC (P23582, 24 a.a. - 126 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in <i>Escherichi
AB-P8981
New product
NPPC (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | NPPC |
| Gene Alias | CNP |
| Gene Description | natriuretic peptide precursor C |
| Storage Conditions | Store, frozen at -20ºC for longer periods of time.<br>For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).<br>Avoid multiple freeze-thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | 20mM Tris-HCl buffer (pH 8.0), 0.15M NaCl and 10% glycerol. |
| Gene ID | 4880 |
More info
Human NPPC (P23582, 24 a.a. - 126 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.