IFIT3 (Human) Recombinant Protein
  • IFIT3 (Human) Recombinant Protein

IFIT3 (Human) Recombinant Protein

Ref: AB-P8765
IFIT3 (Human) Recombinant Protein

Información del producto

Human IFIT3 full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name IFIT3
Gene Alias CIG-49|GARG-49|IFI60|IFIT4|IRG2|ISG60|RIG-G
Gene Description interferon-induced protein with tetratricopeptide repeats 3
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKVKQTCKKFSNPYSIEYSELDCEEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLAIAMYHLDNHPEKQFSTDVLKQAIELSPDNQYVKVLLGLKLQKMNKEAEGEQFVEE
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (1 mg/mL) containing 1X PBS, pH 7.4, 20% glycerol, 1 mM DTT.
Gene ID 3437

Enviar uma mensagem


IFIT3 (Human) Recombinant Protein

IFIT3 (Human) Recombinant Protein