View larger
Canine Csf2 recombinant protein expressed in?<i>Escherichia coli</i>.
AB-P8747
New product
Csf2 (Canine) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | CSF2 |
| Gene Alias | GM-CSF |
| Gene Description | colony stimulating factor 2 (granulocyte-macrophage) |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | APTRSPTLVTRPSQHVDAIQEALSLLNNSNDVTAVMNKAVKVVSEVFDPEGPTCLETRLQLYKEGLQGSLTSLKNPLTMMANHYKQHCPPTPESPCATQNINFKSFKENLKDFLFNIPFDCWKPVKK |
| Form | Lyophilized |
| Antigen species Target species | Dog |
| Storage Buffer | Protein (1 mg/mL) was lyophilized after dialysis against a solution containing 1X PBS, pH7.4. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 403923 |
More info
Canine Csf2 recombinant protein expressed in?Escherichia coli.