GHR (Human) Recombinant Protein
  • GHR (Human) Recombinant Protein

GHR (Human) Recombinant Protein

Ref: AB-P8734
GHR (Human) Recombinant Protein

Información del producto

Human GHR recombinant protein expressed in?Escherichia coli.
Información adicional
Size 20 ug
Gene Name GHR
Gene Alias GHBP
Gene Description growth hormone receptor
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL
Form Lyophilized
Antigen species Target species Human
Storage Buffer Protein (1 mg/mL) was lyophilized from a solution containing 0.0045 mM NaHCO3. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 2690

Enviar uma mensagem


GHR (Human) Recombinant Protein

GHR (Human) Recombinant Protein