GH (Ovien) Recombinant Protein
  • GH (Ovien) Recombinant Protein

GH (Ovien) Recombinant Protein

Ref: AB-P8718
GH (Ovien) Recombinant Protein

Información del producto

Ovien GH recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name GH
Gene Alias GH1
Gene Description growth hormone
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key SDS-PAGE
Immunogen Prot. Seq AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
Form Lyophilized
Storage Buffer Protein (1 mg/mL) was lyophilized from a solution containing 0.0045 mM NaHCO3.Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 443329

Enviar uma mensagem


GH (Ovien) Recombinant Protein

GH (Ovien) Recombinant Protein