AB-P8700
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Size | 20 ug |
Gene Name | GDF15 |
Gene Alias | GDF-15|MIC-1|MIC1|NAG-1|PDF|PLAB|PTGFB |
Gene Description | growth differentiation factor 15 |
Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
Immunogen Prot. Seq | MARNGDDCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI |
Form | Lyophilized |
Antigen species Target species | Human |
Storage Buffer | The protein was lyophilized with no additives. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL |
Gene ID | 9518 |