Gdf5 (Mouse) Recombinant Protein
  • Gdf5 (Mouse) Recombinant Protein

Gdf5 (Mouse) Recombinant Protein

Ref: AB-P8693
Gdf5 (Mouse) Recombinant Protein

Información del producto

Mouse Gdf5 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Gdf5
Gene Alias Cdmp-1|bp|brp
Gene Description growth differentiation factor 5
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSAPLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
Form Liquid
Antigen species Target species Mouse
Storage Buffer Solution (0.5 mg/mL) containing��20 mM Tris-HCl, pH 8.0, 10% glycerol.
Gene ID 14563

Enviar uma mensagem


Gdf5 (Mouse) Recombinant Protein

Gdf5 (Mouse) Recombinant Protein