Lgals9 (Mouse) Recombinant Protein
  • Lgals9 (Mouse) Recombinant Protein

Lgals9 (Mouse) Recombinant Protein

Ref: AB-P8677
Lgals9 (Mouse) Recombinant Protein

Información del producto

Mouse Lgals9 full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Lgals9
Gene Alias AA407335|AI194909|AI265545|gal-9|galectin-9
Gene Description lectin, galactose binding, soluble 9
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIA
Form Liquid
Antigen species Target species Mouse
Storage Buffer Solution (0.5 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 0.4 M Urea.
Gene ID 16859

Enviar uma mensagem


Lgals9 (Mouse) Recombinant Protein

Lgals9 (Mouse) Recombinant Protein