Lgals8 (Mouse) Recombinant Protein
  • Lgals8 (Mouse) Recombinant Protein

Lgals8 (Mouse) Recombinant Protein

Ref: AB-P8675
Lgals8 (Mouse) Recombinant Protein

Información del producto

Mouse Lgals8 full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Lgals8
Gene Alias 1200015E08Rik|AI326142|D13Ertd524e|Lgals-8
Gene Description lectin, galactose binding, soluble 8
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key Func
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMLSLNNLQNIIYNPIIPYVGTITEQLKPGSLIVIRGHVPKDSERFQVDFQLGNSLKPRADVAFHFNPRFKRSSCIVCNTLTQEKWGWEEITYDMPFRKEKSFEIVFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYGKVNIHSIGFRFSSDLQSMETSALGLTQINRENIQKPGKLQLSLPFEARLNASMGPGRTVVIKGEVNTNARSFNVDLVAGKTRDIALHLNPR
Form Liquid
Antigen species Target species Mouse
Storage Buffer Solution (0.5 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 20% glycerol, 0.15 M NaCl, 1 mM DTT.
Gene ID 56048

Enviar uma mensagem


Lgals8 (Mouse) Recombinant Protein

Lgals8 (Mouse) Recombinant Protein