Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
Lgals8 (Mouse) Recombinant Protein
Abnova
Lgals8 (Mouse) Recombinant Protein
Ref: AB-P8675
Lgals8 (Mouse) Recombinant Protein
Contacte-nos
Información del producto
Mouse Lgals8 full-length recombinant protein with His tag in N-terminus expressed in
Escherichia coli
.
Información adicional
Size
2 x 10 ug
Gene Name
Lgals8
Gene Alias
1200015E08Rik|AI326142|D13Ertd524e|Lgals-8
Gene Description
lectin, galactose binding, soluble 8
Storage Conditions
Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key
Func
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMGSMLSLNNLQNIIYNPIIPYVGTITEQLKPGSLIVIRGHVPKDSERFQVDFQLGNSLKPRADVAFHFNPRFKRSSCIVCNTLTQEKWGWEEITYDMPFRKEKSFEIVFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIYGKVNIHSIGFRFSSDLQSMETSALGLTQINRENIQKPGKLQLSLPFEARLNASMGPGRTVVIKGEVNTNARSFNVDLVAGKTRDIALHLNPR
Form
Liquid
Antigen species Target species
Mouse
Storage Buffer
Solution (0.5 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 20% glycerol, 0.15 M NaCl, 1 mM DTT.
Gene ID
56048
Enviar uma mensagem
Lgals8 (Mouse) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*