View larger
Human LGALS7 full-length recombinant protein with His tag in N-terminus expressed in <i>Escherichia coli</i>.
AB-P8671
New product
LGALS7 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | LGALS7 |
| Gene Alias | GAL7|LGALS7A |
| Gene Description | lectin, galactoside-binding, soluble, 7 |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (1 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 1 mM DTT. |
| Gene ID | 3963 |
More info
Human LGALS7 full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.