LGALS3 (Human) Recombinant Protein
  • LGALS3 (Human) Recombinant Protein

LGALS3 (Human) Recombinant Protein

Ref: AB-P8664
LGALS3 (Human) Recombinant Protein

Información del producto

Human LGALS3 recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name LGALS3
Gene Alias CBP35|GAL3|GALBP|GALIG|LGALS2|MAC2
Gene Description lectin, galactoside-binding, soluble, 3
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key SDS-PAGE
Immunogen Prot. Seq MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 10 mM sodium phosphate, pH 7.5, 50 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 3958

Enviar uma mensagem


LGALS3 (Human) Recombinant Protein

LGALS3 (Human) Recombinant Protein