LGALS3 (Human) Recombinant Protein View larger

Human LGALS3 recombinant protein expressed in <i>Escherichia coli</i>.

AB-P8664

New product

LGALS3 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 ug
Gene Name LGALS3
Gene Alias CBP35|GAL3|GALBP|GALIG|LGALS2|MAC2
Gene Description lectin, galactoside-binding, soluble, 3
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe
Immunogen Prot. Seq MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 10 mM sodium phosphate, pH 7.5, 50 mM NaCl. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 3958

More info

Human LGALS3 recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human LGALS3 recombinant protein expressed in <i>Escherichia coli</i>.

Human LGALS3 recombinant protein expressed in <i>Escherichia coli</i>.