Lgals2 (Mouse) Recombinant Protein
  • Lgals2 (Mouse) Recombinant Protein

Lgals2 (Mouse) Recombinant Protein

Ref: AB-P8662
Lgals2 (Mouse) Recombinant Protein

Información del producto

Mouse Lgals2 full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name Lgals2
Gene Alias 2200008F12Rik|AI324147
Gene Description lectin, galactose-binding, soluble 2
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSMSEKFEVKDLNMKPGMSLKIKGKIHNDVDRFLINLGQGKETLNLHFNPRFDESTIVCNTSEGGRWGQEQRENHMCFSPGSEVKITITFQDKDFKVTLPDGHQLTFPNRLGHNQLHYLSMGGLQISSFKLE
Form Liquid
Antigen species Target species Mouse
Storage Buffer Solution (1 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 0.1 M NaCl, 1 mM DTT.
Gene ID 107753

Enviar uma mensagem


Lgals2 (Mouse) Recombinant Protein

Lgals2 (Mouse) Recombinant Protein