HBEGF (Human) Recombinant Protein
  • HBEGF (Human) Recombinant Protein

HBEGF (Human) Recombinant Protein

Ref: AB-P8658
HBEGF (Human) Recombinant Protein

Información del producto

Human HBEGF partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name HBEGF
Gene Alias DTR|DTS|DTSF|HEGFL
Gene Description heparin-binding EGF-like growth factor
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (0.5 mg/mL) containing��20 mM Tris-HCl, pH 8.0, 50% glycerol, 0.2 M NaCl, 2 mM DTT.
Gene ID 1839

Enviar uma mensagem


HBEGF (Human) Recombinant Protein

HBEGF (Human) Recombinant Protein