Hbegf (Mouse) Recombinant Protein
  • Hbegf (Mouse) Recombinant Protein

Hbegf (Mouse) Recombinant Protein

Ref: AB-P8656
Hbegf (Mouse) Recombinant Protein

Información del producto

Mouse Hbegf partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name Hbegf
Gene Alias AW047313|DTS|Dtr|HB-EGF|Hegfl|MGC107656
Gene Description heparin-binding EGF-like growth factor
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq DLEGTDLNLFKVAFSSKPQGLATPSKERNGKKKKKGKGLGKKRDPCLRKYKDYCIHGECRYLQEFRTPSCKCLPGYHGHRCHGLTL
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from a solution containing 10mM PB, pH 7.4, 500mM NaCl. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 15200

Enviar uma mensagem


Hbegf (Mouse) Recombinant Protein

Hbegf (Mouse) Recombinant Protein