HBEGF (Human) Recombinant Protein
  • HBEGF (Human) Recombinant Protein

HBEGF (Human) Recombinant Protein

Ref: AB-P8655
HBEGF (Human) Recombinant Protein

Información del producto

Human HBEGF recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name HBEGF
Gene Alias DTR|DTS|DTSF|HEGFL
Gene Description heparin-binding EGF-like growth factor
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq MDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL
Form Lyophilized
Antigen species Target species Human
Storage Buffer Protein (1 mg/mL) was lyophilized from a solution containing 10mM sodium phosphate, pH 7.5. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 1839

Enviar uma mensagem


HBEGF (Human) Recombinant Protein

HBEGF (Human) Recombinant Protein