View larger
Human FST partial recombinant protein with His tag in C-terminus expressed in Baculovirus.
AB-P8652
New product
FST (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | FST |
| Gene Alias | FS |
| Gene Description | follistatin |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPV |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (0.25 mg/mL) containing��1X PBS, pH 7.4, 10% glycerol. |
| Gene ID | 10468 |
More info
Human FST partial recombinant protein with His tag in C-terminus expressed in Baculovirus.