Flt3l (Mouse) Recombinant Protein
  • Flt3l (Mouse) Recombinant Protein

Flt3l (Mouse) Recombinant Protein

Ref: AB-P8645
Flt3l (Mouse) Recombinant Protein

Información del producto

Mouse Flt3l recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Flt3l
Gene Alias Flt3lg|Ly72L
Gene Description FMS-like tyrosine kinase 3 ligand
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq MTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQ
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from a solution containing 10 mM sodium phosphate, pH 7.5. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 14256

Enviar uma mensagem


Flt3l (Mouse) Recombinant Protein

Flt3l (Mouse) Recombinant Protein