AB-P8643
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Size | 2 x 10 ug |
Gene Name | FLT3LG |
Gene Alias | FL |
Gene Description | fms-related tyrosine kinase 3 ligand |
Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
Immunogen Prot. Seq | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP |
Form | Lyophilized |
Antigen species Target species | Human |
Storage Buffer | Lyophilized from a solution containing 1X PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
Gene ID | 2323 |