FLT3LG (Human) Recombinant Protein
  • FLT3LG (Human) Recombinant Protein

FLT3LG (Human) Recombinant Protein

Ref: AB-P8642
FLT3LG (Human) Recombinant Protein

Información del producto

Human FLT3LG recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name FLT3LG
Gene Alias FL
Gene Description fms-related tyrosine kinase 3 ligand
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTA
Form Lyophilized
Antigen species Target species Human
Storage Buffer The protein was lyophilized with no additives. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 2323

Enviar uma mensagem


FLT3LG (Human) Recombinant Protein

FLT3LG (Human) Recombinant Protein