FGF22 (Human) Recombinant Protein
  • FGF22 (Human) Recombinant Protein

FGF22 (Human) Recombinant Protein

Ref: AB-P8635
FGF22 (Human) Recombinant Protein

Información del producto

Human FGF22 recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name FGF22
Gene Alias -
Gene Description fibroblast growth factor 22
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key SDS-PAGE
Immunogen Prot. Seq MTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS
Form Lyophilized
Antigen species Target species Human
Storage Buffer The protein was lyophilized with no additives.
Gene ID 27006

Enviar uma mensagem


FGF22 (Human) Recombinant Protein

FGF22 (Human) Recombinant Protein