FGF19 (Human) Recombinant Protein
  • FGF19 (Human) Recombinant Protein

FGF19 (Human) Recombinant Protein

Ref: AB-P8624
FGF19 (Human) Recombinant Protein

Información del producto

Human FGF19 recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name FGF19
Gene Alias -
Gene Description fibroblast growth factor 19
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq MRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Form Lyophilized
Antigen species Target species Human
Storage Buffer Protein(1 mg/mL) was lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in 1X PBS to 100 ug/mL.
Gene ID 9965

Enviar uma mensagem


FGF19 (Human) Recombinant Protein

FGF19 (Human) Recombinant Protein