Fgf17 (Mouse) Recombinant Protein View larger

Mouse Fgf17 recombinant protein expressed in?<i>Escherichia coli</i>.

AB-P8619

New product

Fgf17 (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 20 ug
Gene Name Fgf17
Gene Alias -
Gene Description fibroblast growth factor 17
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from 20 mM Tris-HCl buffer(pH 8.0) cantaining?0.02% Tween-20 and 700 mM NaCl. Reconstitute the lyophilized powder in PBS to 100 ug/mL.
Gene ID 14171

More info

Mouse Fgf17 recombinant protein expressed in?Escherichia coli.

Enviar uma mensagem

Mouse Fgf17 recombinant protein expressed in?<i>Escherichia coli</i>.

Mouse Fgf17 recombinant protein expressed in?<i>Escherichia coli</i>.