Fgf16 (Mouse) Recombinant Protein
  • Fgf16 (Mouse) Recombinant Protein

Fgf16 (Mouse) Recombinant Protein

Ref: AB-P8616
Fgf16 (Mouse) Recombinant Protein

Información del producto

Mouse Fgf16 recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name Fgf16
Gene Alias -
Gene Description fibroblast growth factor 16
Storage Conditions Stored at 4C for 2-4 weeks, should be stored at -20C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFRYR
Form Liquid
Antigen species Target species Mouse
Storage Buffer Solution in 20mM Tris-HCl buffer (pH 9.0) cantaining 10% Glycerol, 1M NaCl, 0.02% Tween-20.
Gene ID 80903

Enviar uma mensagem


Fgf16 (Mouse) Recombinant Protein

Fgf16 (Mouse) Recombinant Protein