FGF9 (Human) Recombinant Protein View larger

Human FGF9 recombinant protein expressed in?<i>Escherichia coli</i>.

AB-P8607

New product

FGF9 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 20 ug
Gene Name FGF9
Gene Alias GAF|HBFG-9|MGC119914|MGC119915
Gene Description fibroblast growth factor 9 (glia-activating factor)
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe
Immunogen Prot. Seq APLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Form Lyophilized
Antigen species Target species Human
Storage Buffer Protein(1 mg/mL) was lyophilized from a solution containing 1X PBS. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 2254

More info

Human FGF9 recombinant protein expressed in?Escherichia coli.

Enviar uma mensagem

Human FGF9 recombinant protein expressed in?<i>Escherichia coli</i>.

Human FGF9 recombinant protein expressed in?<i>Escherichia coli</i>.