FGF2 (Human) Recombinant Protein View larger

Human FGF2 recombinant protein expressed in?<i>Escherichia coli</i>.

AB-P8594

New product

FGF2 (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 ug
Gene Name FGF2
Gene Alias BFGF|FGFB|HBGF-2
Gene Description fibroblast growth factor 2 (basic)
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe
Immunogen Prot. Seq MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from a solution containing 20mM Tris-HCl, pH 7.6, 150mM NaCl. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 2247

More info

Human FGF2 recombinant protein expressed in?Escherichia coli.

Enviar uma mensagem

Human FGF2 recombinant protein expressed in?<i>Escherichia coli</i>.

Human FGF2 recombinant protein expressed in?<i>Escherichia coli</i>.