EREG (Human) Recombinant Protein
  • EREG (Human) Recombinant Protein

EREG (Human) Recombinant Protein

Ref: AB-P8570
2 x 10 ug

Información del producto

EREG (Human) Recombinant Protein
Información adicional
Size 2 x 10 ug
Gene Name EREG
Gene Alias ER
Gene Description epiregulin
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq DGSMVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ
Form Liquid
Antigen species Target species Human
Storage Buffer EREG protein (0.25mg/ml) contains 10% glycerol and Phosphate-Buffered Saline (pH 7.4).
Gene ID 2069

Enviar uma mensagem


EREG (Human) Recombinant Protein

EREG (Human) Recombinant Protein