EPGN (Human) Recombinant Protein
  • EPGN (Human) Recombinant Protein

EPGN (Human) Recombinant Protein

Ref: AB-P8565
EPGN (Human) Recombinant Protein

Información del producto

Human EPGN (Q6UW88) recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name EPGN
Gene Alias ALGV3072|EPG|FLJ75542|PRO9904|epigen
Gene Description epithelial mitogen homolog (mouse)
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYA.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 20mM sodium Phosphate buffer (pH 7.5) and 130mM sodium chloride.
Gene ID 255324

Enviar uma mensagem


EPGN (Human) Recombinant Protein

EPGN (Human) Recombinant Protein