Eng (Mouse) Recombinant Protein
  • Eng (Mouse) Recombinant Protein

Eng (Mouse) Recombinant Protein

Ref: AB-P8564
Eng (Mouse) Recombinant Protein

Información del producto

Mouse Eng (Q63961, 27a.a. - 581 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in Baculovirus.
Información adicional
Size 5 ug
Gene Name Eng
Gene Alias AI528660|AI662476|CD105|S-endoglin
Gene Description endoglin
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKI
Form Liquid
Antigen species Target species Mouse
Storage Buffer Endoglin protein solution (0.5mg/ml) containing Phosphate Buffered Saline (pH 7.4) and 10% glycerol.
Gene ID 13805

Enviar uma mensagem


Eng (Mouse) Recombinant Protein

Eng (Mouse) Recombinant Protein