ENG (Human) Recombinant Protein
  • ENG (Human) Recombinant Protein

ENG (Human) Recombinant Protein

Ref: AB-P8562
2 x 10 ug

Información del producto

ENG (Human) Recombinant Protein
Información adicional
Size 2 x 10 ug
Gene Name ENG
Gene Alias CD105|END|FLJ41744|HHT1|ORW|ORW1
Gene Description endoglin
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSETVHCDLQPVGPERDEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAP
Form Liquid
Antigen species Target species Human
Storage Buffer The Endoglin solution (0.25mg/ml) contains 20mM Tris-HCl buffer (pH 8.0), 1mM DTT, 150mM NaCl and 10% glycerol.
Gene ID 2022

Enviar uma mensagem


ENG (Human) Recombinant Protein

ENG (Human) Recombinant Protein