Egf (Rat) Recombinant Protein
  • Egf (Rat) Recombinant Protein

Egf (Rat) Recombinant Protein

Ref: AB-P8555
100 ug

Información del producto

Egf (Rat) Recombinant Protein
Información adicional
Size 100 ug
Gene Name Egf
Gene Alias -
Gene Description epidermal growth factor
Storage Conditions Store, frozen at -20C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq NSNTGCPPSYDGYCLNGGVCMYVESVDRYVCNCVIGYIGERCQHRDLRWWKLR.
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from PBS, pH 7.4.
Gene ID 25313

Enviar uma mensagem


Egf (Rat) Recombinant Protein

Egf (Rat) Recombinant Protein