View larger
Mouse Egf (P01132, 977 a.a. - 1029 a.a.) partial-length recombinant protein with N-terminal His-tag expressed in <i>Escherichia
AB-P8552
New product
Egf (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | Egf |
| Gene Alias | AI790464 |
| Gene Description | epidermal growth factor |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSMNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR. |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | The EGF solution (0.5mg/1ml) contains 20mM Tris-HCl buffer (pH 8.0), 100mM NaCl, 2mM DTT and 10% glycerol. |
| Gene ID | 13645 |
More info
Mouse Egf (P01132, 977 a.a. - 1029 a.a.) partial-length recombinant protein with N-terminal His-tag expressed in Escherichia coli.