View larger
Human EGF (P01133) recombinant protein expressed in <i>Escherichia coli</i>.
AB-P8547
New product
EGF (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | EGF |
| Gene Alias | HOMG4|URG |
| Gene Description | epidermal growth factor (beta-urogastrone) |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQVNFAHYGNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 10mM HCl. |
| Gene ID | 1950 |
More info
Human EGF (P01133) recombinant protein expressed in Escherichia coli.