EGF (Human) Recombinant Protein View larger

Human EGF (P01133) recombinant protein expressed in <i>Escherichia coli</i>.

AB-P8547

New product

EGF (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 100 ug
Gene Name EGF
Gene Alias HOMG4|URG
Gene Description epidermal growth factor (beta-urogastrone)
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq MFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQVNFAHYGNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 10mM HCl.
Gene ID 1950

More info

Human EGF (P01133) recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human EGF (P01133) recombinant protein expressed in <i>Escherichia coli</i>.

Human EGF (P01133) recombinant protein expressed in <i>Escherichia coli</i>.