EGF (Human) Recombinant Protein View larger

Human EGF (P01133) recombinant protein expressed in <i>Escherichia coli</i>.

AB-P8544

New product

EGF (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.


Data sheet

Size 100 ug
Gene Name EGF
Gene Alias HOMG4|URG
Gene Description epidermal growth factor (beta-urogastrone)
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS pH-7.4.
Gene ID 1950

More info

Human EGF (P01133) recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human EGF (P01133) recombinant protein expressed in <i>Escherichia coli</i>.

Human EGF (P01133) recombinant protein expressed in <i>Escherichia coli</i>.