EGF (Human) Recombinant Protein
  • EGF (Human) Recombinant Protein

EGF (Human) Recombinant Protein

Ref: AB-P8544
100 ug

Información del producto

EGF (Human) Recombinant Protein
Información adicional
Size 100 ug
Gene Name EGF
Gene Alias HOMG4|URG
Gene Description epidermal growth factor (beta-urogastrone)
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS pH-7.4.
Gene ID 1950

Enviar uma mensagem


EGF (Human) Recombinant Protein

EGF (Human) Recombinant Protein