EBI3 (Human) Recombinant Protein
  • EBI3 (Human) Recombinant Protein

EBI3 (Human) Recombinant Protein

Ref: AB-P8541
EBI3 (Human) Recombinant Protein

Información del producto

Human EBI3 (Q14213) recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name EBI3
Gene Alias IL27B
Gene Description Epstein-Barr virus induced 3
Storage Conditions Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution EBI3 Macaque should be stored at 4C between 2-7 days and for future use below -18C.
Application Key SDS-PAGE
Immunogen Prot. Seq MRKGPPAALTLPRVQCRAPRYPIAVDCSWTLPPAPNSTSPVSFIATYRFGMAARGHSWPCLQQTPASTSCTIADVRLFSMAPYVLNVTAVHPWGSSSSFVPFIAEHIIKPDPPEGVRLSPLAERQLQVQWEPPRSWPFPEIFSLKYWIRYKRQGAARFHQVGPIEATSFILRAVRPRARYCVQVAAQDLTDYGELSDWSLPATTPMSPGK.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 0.1 % trifluoroacetic acid (TFA).
Gene ID 10148

Enviar uma mensagem


EBI3 (Human) Recombinant Protein

EBI3 (Human) Recombinant Protein