EBI3 (Human) Recombinant Protein
  • EBI3 (Human) Recombinant Protein

EBI3 (Human) Recombinant Protein

Ref: AB-P8541
20 ug

Información del producto

EBI3 (Human) Recombinant Protein
Información adicional
Size 20 ug
Gene Name EBI3
Gene Alias IL27B
Gene Description Epstein-Barr virus induced 3
Storage Conditions Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution EBI3 Macaque should be stored at 4C between 2-7 days and for future use below -18C.
Application Key SDS-PAGE
Immunogen Prot. Seq MRKGPPAALTLPRVQCRAPRYPIAVDCSWTLPPAPNSTSPVSFIATYRFGMAARGHSWPCLQQTPASTSCTIADVRLFSMAPYVLNVTAVHPWGSSSSFVPFIAEHIIKPDPPEGVRLSPLAERQLQVQWEPPRSWPFPEIFSLKYWIRYKRQGAARFHQVGPIEATSFILRAVRPRARYCVQVAAQDLTDYGELSDWSLPATTPMSPGK.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 0.1 % trifluoroacetic acid (TFA).
Gene ID 10148

Enviar uma mensagem


EBI3 (Human) Recombinant Protein

EBI3 (Human) Recombinant Protein