DEFB118 (Human) Recombinant Protein
  • DEFB118 (Human) Recombinant Protein

DEFB118 (Human) Recombinant Protein

Ref: AB-P8538
DEFB118 (Human) Recombinant Protein

Información del producto

Human DEFB118 (Q96PH6, 21 a.a.- 229 a.a.) partial-length recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name DEFB118
Gene Alias C20orf63|DEFB-18|ESC42|dJ1018D12.3
Gene Description defensin, beta 118
Storage Conditions Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution EBI3 should be stored at 4C between 2-7 days and for future use below -18C. Please prevent freeze-thaw cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 10mM Acetic Acid and 0.5% Mannitol.
Gene ID 117285

Enviar uma mensagem


DEFB118 (Human) Recombinant Protein

DEFB118 (Human) Recombinant Protein