DEFB118 (Human) Recombinant Protein
  • DEFB118 (Human) Recombinant Protein

DEFB118 (Human) Recombinant Protein

Ref: AB-P8537
DEFB118 (Human) Recombinant Protein

Información del producto

Human DEFB118 (Q96PH6, 21 a.a.- 123 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name DEFB118
Gene Alias C20orf63|DEFB-18|ESC42|dJ1018D12.3
Gene Description defensin, beta 118
Storage Conditions Store at 4C if entire vial will be used within 2-4 weeks. Store, frozen at -20C for longer periods of time.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSS.
Form Liquid
Antigen species Target species Human
Storage Buffer 20mM Tris-HCl buffer (pH8.0), 0.15M NaCl, 20% glycerol and 1mM DTT.
Gene ID 117285

Enviar uma mensagem


DEFB118 (Human) Recombinant Protein

DEFB118 (Human) Recombinant Protein