DEFB116 (Human) Recombinant Protein
  • DEFB116 (Human) Recombinant Protein

DEFB116 (Human) Recombinant Protein

Ref: AB-P8536
2 x 10 ug

Información del producto

DEFB116 (Human) Recombinant Protein
Información adicional
Size 2 x 10 ug
Gene Name DEFB116
Gene Alias DEFB-16
Gene Description defensin, beta 116
Storage Conditions Store at 4C if entire vial will be used within 2-4 weeks. Store, frozen at -20C for longer periods of time.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSGLFRSHNGKSREPWNPCELYQGMCRNACREYEIQYLTCPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSYSHI.
Form Liquid
Antigen species Target species Human
Storage Buffer DEFB116 protein solution (0.5mg/ml) containing 20mM Tris-HCl buffer (pH8.0), 10% glycerol and 0.4M Urea.
Gene ID 245930

Enviar uma mensagem


DEFB116 (Human) Recombinant Protein

DEFB116 (Human) Recombinant Protein