View larger
Human CTLA4 (P16410, 36 a.a. - 161 a.a) partial-length recombinant protein with hIgG-His-tag at C-terminal expressed in <i>Bacul
AB-P8532
New product
CTLA4 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | CTLA4 |
| Gene Alias | CD152|CELIAC3|CTLA-4|GSE|IDDM12 |
| Gene Description | cytotoxic T-lymphocyte-associated protein 4 |
| Storage Conditions | Store at 4ºC if entire vial will be used within 2-4 weeks. |
| Immunogen Prot. Seq | ADLKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | The CTLA4 solution (0.5mg/ml) contains 10% Glycerol and Phosphate-Buffered Saline (pH 7.4). |
| Gene ID | 1493 |
More info
Human CTLA4 (P16410, 36 a.a. - 161 a.a) partial-length recombinant protein with hIgG-His-tag at C-terminal expressed in Baculovirus.