CTLA4 (Human) Recombinant Protein
  • CTLA4 (Human) Recombinant Protein

CTLA4 (Human) Recombinant Protein

Ref: AB-P8532
50 ug

Información del producto

CTLA4 (Human) Recombinant Protein
Información adicional
Size 50 ug
Gene Name CTLA4
Gene Alias CD152|CELIAC3|CTLA-4|GSE|IDDM12
Gene Description cytotoxic T-lymphocyte-associated protein 4
Storage Conditions Store at 4C if entire vial will be used within 2-4 weeks.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ADLKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
Form Liquid
Antigen species Target species Human
Storage Buffer The CTLA4 solution (0.5mg/ml) contains 10% Glycerol and Phosphate-Buffered Saline (pH 7.4).
Gene ID 1493

Enviar uma mensagem


CTLA4 (Human) Recombinant Protein

CTLA4 (Human) Recombinant Protein