View larger
Human CCN2 (P29279, 183 a.a.- 255 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in in HEK293 cel
AB-P8527
New product
CCN2 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | CTGF |
| Gene Alias | CCN2|HCS24|IGFBP8|MGC102839|NOV2 |
| Gene Description | connective tissue growth factor |
| Storage Conditions | Store lyophilized protein at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4ºC for a limited period of time |
| Immunogen Prot. Seq | MHHHHHHRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVRPCEADLEENIKKGKK. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | CTGF filtered (0.4 um) and lyophilized from 0.5mg/ml in 20 mM Tris buffer and 50 mM NaCl, pH 7.5. |
| Gene ID | 1490 |
More info
Human CCN2 (P29279, 183 a.a.- 255 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in in HEK293 cells.