AB-P8527
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Size | 2 x 10 ug |
Gene Name | CTGF |
Gene Alias | CCN2|HCS24|IGFBP8|MGC102839|NOV2 |
Gene Description | connective tissue growth factor |
Storage Conditions | Store lyophilized protein at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4ºC for a limited period of time |
Immunogen Prot. Seq | MHHHHHHRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVRPCEADLEENIKKGKK. |
Form | Lyophilized |
Antigen species Target species | Human |
Storage Buffer | CTGF filtered (0.4 um) and lyophilized from 0.5mg/ml in 20 mM Tris buffer and 50 mM NaCl, pH 7.5. |
Gene ID | 1490 |