CCN2 (Human) Recombinant Protein
  • CCN2 (Human) Recombinant Protein

CCN2 (Human) Recombinant Protein

Ref: AB-P8527
CCN2 (Human) Recombinant Protein

Información del producto

Human CCN2 (P29279, 183 a.a.- 255 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in in HEK293 cells.
Información adicional
Size 2 x 10 ug
Gene Name CTGF
Gene Alias CCN2|HCS24|IGFBP8|MGC102839|NOV2
Gene Description connective tissue growth factor
Storage Conditions Store lyophilized protein at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4C for a limited period of time
it does not show any change after two weeks at 4C.
Application Key SDS-PAGE
Immunogen Prot. Seq MHHHHHHRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVRPCEADLEENIKKGKK.
Form Lyophilized
Antigen species Target species Human
Storage Buffer CTGF filtered (0.4 um) and lyophilized from 0.5mg/ml in 20 mM Tris buffer and 50 mM NaCl, pH 7.5.
Gene ID 1490

Enviar uma mensagem


CCN2 (Human) Recombinant Protein

CCN2 (Human) Recombinant Protein