Ctf1 (Rat) Recombinant Protein
  • Ctf1 (Rat) Recombinant Protein

Ctf1 (Rat) Recombinant Protein

Ref: AB-P8521
2 x 10 ug

Información del producto

Ctf1 (Rat) Recombinant Protein
Información adicional
Size 2 x 10 ug
Gene Name Ctf1
Gene Alias -
Gene Description cardiotrophin 1
Storage Conditions Lyophilized Cardiotrophin-1 Rat although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution CTF1 Rat should be stored at 4C between 2-7 days and for future use below -18C.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSQREGSLEDHQTDSSFSFLPHLEAKIRQTHNLARLLTKYADQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSALPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPVPEPVATSALFTSNSAAGVFSAKVLGLHVCGLYGEWVSRTEGDLGQLVPGGVA.
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4.
Gene ID 29201

Enviar uma mensagem


Ctf1 (Rat) Recombinant Protein

Ctf1 (Rat) Recombinant Protein