CTF1 (Human) Recombinant Protein
  • CTF1 (Human) Recombinant Protein

CTF1 (Human) Recombinant Protein

Ref: AB-P8518
CTF1 (Human) Recombinant Protein

Información del producto

Human CTF1 (Q16619) recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name CTF1
Gene Alias CT-1|CT1
Gene Description cardiotrophin 1
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA.
Form Lyophilized
Antigen species Target species Human
Storage Buffer CTF-1 protein was lyophilized from a 0.2um filtered concentrated solution in 30% Acetonitrile and 0.1% TFA.
Gene ID 1489

Enviar uma mensagem


CTF1 (Human) Recombinant Protein

CTF1 (Human) Recombinant Protein